Class b: All beta proteins [48724] (176 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.11: Kelch motif [117281] (2 families) |
Family b.68.11.1: Kelch motif [117282] (2 proteins) Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967) |
Protein automated matches [190126] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186850] (3 PDB entries) |
Domain d1x2ra_: 1x2r A: [121647] automated match to d1u6dx_ complexed with so4; mutant |
PDB Entry: 1x2r (more details), 1.7 Å
SCOPe Domain Sequences for d1x2ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2ra_ b.68.11.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc
Timeline for d1x2ra_: