Lineage for d1x2ra_ (1x2r A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808612Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2808613Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2808622Protein automated matches [190126] (2 species)
    not a true protein
  7. 2808674Species Mouse (Mus musculus) [TaxId:10090] [186850] (30 PDB entries)
  8. 2808682Domain d1x2ra_: 1x2r A: [121647]
    automated match to d1u6dx_
    complexed with so4; mutant

Details for d1x2ra_

PDB Entry: 1x2r (more details), 1.7 Å

PDB Description: Structural basis for the defects of human lung cancer somatic mutations in the repression activity of Keap1 on Nrf2
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d1x2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2ra_ b.68.11.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns
pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery
eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm
ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq
gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc

SCOPe Domain Coordinates for d1x2ra_:

Click to download the PDB-style file with coordinates for d1x2ra_.
(The format of our PDB-style files is described here.)

Timeline for d1x2ra_: