Lineage for d1x2ra1 (1x2r A:324-613)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674916Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 675253Superfamily b.68.11: Kelch motif [117281] (1 family) (S)
  5. 675254Family b.68.11.1: Kelch motif [117282] (1 protein)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (scop_pr 50967)
  6. 675255Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (2 species)
  7. 675259Species Mouse (Mus musculus) [TaxId:10090] [141550] (2 PDB entries)
  8. 675261Domain d1x2ra1: 1x2r A:324-613 [121647]
    automatically matched to 1X2J A:324-613
    complexed with so4; mutant

Details for d1x2ra1

PDB Entry: 1x2r (more details), 1.7 Å

PDB Description: Structural basis for the defects of human lung cancer somatic mutations in the repression activity of Keap1 on Nrf2
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOP Domain Sequences for d1x2ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2ra1 b.68.11.1 (A:324-613) Kelch-like ECH-associated protein 1, KEAP1 {Mouse (Mus musculus) [TaxId: 10090]}
vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns
pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery
eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm
ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq
gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepc

SCOP Domain Coordinates for d1x2ra1:

Click to download the PDB-style file with coordinates for d1x2ra1.
(The format of our PDB-style files is described here.)

Timeline for d1x2ra1: