SCOPe 2.08: Domain d1x1xc_: 1x1x C:

Lineage for d1x1xc_ (1x1x C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)

8. Domain d1x1xc_: 1x1x C: [121609]
   Other proteins in same PDB: d1x1xd1, d1x1xe_, d1x1xf_
   automated match to d1b27a_

Details for d1x1xc_

PDB Entry: 1x1x, 2.3 Å

PDB Description: water-mediate interaction at aprotein-protein interface

PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d1x1xc_:

Sequence; same for both SEQRES and ATOM records:

>d1x1xc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d1x1xc_:

• d1x1xc_ first appeared in SCOP 1.73, called d1x1xc1
  
• d1x1xc_ appears in SCOPe 2.07