SCOPe 2.08: Domain d1x1xe_: 1x1x E:

Lineage for d1x1xe_ (1x1x E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.1: Barstar-related [52038] (1 family)
   automatically mapped to Pfam PF01337

5. Family c.9.1.1: Barstar-related [52039] (3 proteins)

6. Protein Barstar (barnase inhibitor) [52040] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (15 PDB entries)

8. Domain d1x1xe_: 1x1x E: [144571]
   Other proteins in same PDB: d1x1xa_, d1x1xb_, d1x1xc_
   automated match to d1x1xd1

Details for d1x1xe_

PDB Entry: 1x1x, 2.3 Å

PDB Description: water-mediate interaction at aprotein-protein interface

PDB Compounds: (E:) barstar

SCOPe Domain Sequences for d1x1xe_:

Sequence; same for both SEQRES and ATOM records:

>d1x1xe_ c.9.1.1 (E:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk
qltengaesvlqvfraakaegaditiils

Timeline for d1x1xe_:

• d1x1xe_ first appeared in SCOP 1.75, called d1x1xe1
  
• d1x1xe_ appears in SCOPe 2.07