![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Amylomaltase MalQ [51478] (3 species) 4-alpha-glucanotransferase; single-domain amylase with several insertions in the common fold |
![]() | Species Potato (Solanum tuberosum) [TaxId:4113] [141771] (4 PDB entries) Uniprot Q06801 54-576 |
![]() | Domain d1x1na1: 1x1n A:2-524 [121593] complexed with ca, gol has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1x1n (more details), 1.8 Å
SCOPe Domain Sequences for d1x1na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} vpavgedfpidyadwlpkrdpndrrragillhptsfpgpygigdlgpqafkfldwlhlag cslwqvlplvppgkrgnedgspysgqdancgntllisleelvddgllkmeelpeplptdr vnystiseikdplitkaakrllssegelkdqlenfrrdpnisswledaayfaaidnsvnt iswydwpeplknrhlaaleevyqsekdfidifiaqqflfqrqwkkvrdyarskgisimgd mpiyvgyhsadvwankkqfllnrkgfplivsgvppdafsetgqlwgsplydwkamekdgf swwvrriqratdlfdefridhfrgfagfwavpseekiailgrwkvgpgkplfdailqavg kiniiaedlgvitedvvqlrksieapgmavlqfafgsdaenphlphnheqnqvvytgthd ndtirgwwdtlpqeeksnvlkylsnieeeeisrgliegavssvariaiipmqdvlglgsd srmnipatqfgnwswripsstsfdnldaeakklrdilatygrl
Timeline for d1x1na1: