Lineage for d1x1na1 (1x1n A:2-524)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2829836Protein Amylomaltase MalQ [51478] (3 species)
    4-alpha-glucanotransferase; single-domain amylase with several insertions in the common fold
  7. 2829840Species Potato (Solanum tuberosum) [TaxId:4113] [141771] (4 PDB entries)
    Uniprot Q06801 54-576
  8. 2829841Domain d1x1na1: 1x1n A:2-524 [121593]
    complexed with ca, gol
    has additional insertions and/or extensions that are not grouped together

Details for d1x1na1

PDB Entry: 1x1n (more details), 1.8 Å

PDB Description: Structure determination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1x1na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]}
vpavgedfpidyadwlpkrdpndrrragillhptsfpgpygigdlgpqafkfldwlhlag
cslwqvlplvppgkrgnedgspysgqdancgntllisleelvddgllkmeelpeplptdr
vnystiseikdplitkaakrllssegelkdqlenfrrdpnisswledaayfaaidnsvnt
iswydwpeplknrhlaaleevyqsekdfidifiaqqflfqrqwkkvrdyarskgisimgd
mpiyvgyhsadvwankkqfllnrkgfplivsgvppdafsetgqlwgsplydwkamekdgf
swwvrriqratdlfdefridhfrgfagfwavpseekiailgrwkvgpgkplfdailqavg
kiniiaedlgvitedvvqlrksieapgmavlqfafgsdaenphlphnheqnqvvytgthd
ndtirgwwdtlpqeeksnvlkylsnieeeeisrgliegavssvariaiipmqdvlglgsd
srmnipatqfgnwswripsstsfdnldaeakklrdilatygrl

SCOPe Domain Coordinates for d1x1na1:

Click to download the PDB-style file with coordinates for d1x1na1.
(The format of our PDB-style files is described here.)

Timeline for d1x1na1: