SCOP 1.73: Domain d1x1na1: 1x1n A:2-524

Lineage for d1x1na1 (1x1n A:2-524)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Amylomaltase MalQ [51478] (3 species)
   4-alpha-glucanotransferase; single-domain amylase with several insertions in the common fold

7. Species Potato (Solanum tuberosum) [TaxId:4113] [141771] (1 PDB entry)

8. Domain d1x1na1: 1x1n A:2-524 [121593]
   complexed with ca, gol

Details for d1x1na1

PDB Entry: 1x1n, 1.8 Å

PDB Description: Structure determination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato

PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOP Domain Sequences for d1x1na1:

Sequence; same for both SEQRES and ATOM records:

>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]}
vpavgedfpidyadwlpkrdpndrrragillhptsfpgpygigdlgpqafkfldwlhlag
cslwqvlplvppgkrgnedgspysgqdancgntllisleelvddgllkmeelpeplptdr
vnystiseikdplitkaakrllssegelkdqlenfrrdpnisswledaayfaaidnsvnt
iswydwpeplknrhlaaleevyqsekdfidifiaqqflfqrqwkkvrdyarskgisimgd
mpiyvgyhsadvwankkqfllnrkgfplivsgvppdafsetgqlwgsplydwkamekdgf
swwvrriqratdlfdefridhfrgfagfwavpseekiailgrwkvgpgkplfdailqavg
kiniiaedlgvitedvvqlrksieapgmavlqfafgsdaenphlphnheqnqvvytgthd
ndtirgwwdtlpqeeksnvlkylsnieeeeisrgliegavssvariaiipmqdvlglgsd
srmnipatqfgnwswripsstsfdnldaeakklrdilatygrl

Timeline for d1x1na1:

• d1x1na1 is new in SCOP 1.73
  
• d1x1na1 appears in SCOP 1.75
  
• d1x1na1 appears in the current release, SCOPe 2.08