PDB entry 1x1n

View 1x1n on RCSB PDB site
Description: Structure determination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato
Class: transferase
Keywords: Disproportionating enzyme, amylomaltase, D-enzyme, TRANSFERASE
Deposited on 2005-04-08, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x1na1
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x1nA (A:)
    avpavgedfpidyadwlpkrdpndrrragillhptsfpgpygigdlgpqafkfldwlhla
    gcslwqvlplvppgkrgnedgspysgqdancgntllisleelvddgllkmeelpeplptd
    rvnystiseikdplitkaakrllssegelkdqlenfrrdpnisswledaayfaaidnsvn
    tiswydwpeplknrhlaaleevyqsekdfidifiaqqflfqrqwkkvrdyarskgisimg
    dmpiyvgyhsadvwankkqfllnrkgfplivsgvppdafsetgqlwgsplydwkamekdg
    fswwvrriqratdlfdefridhfrgfagfwavpseekiailgrwkvgpgkplfdailqav
    gkiniiaedlgvitedvvqlrksieapgmavlqfafgsdaenphlphnheqnqvvytgth
    dndtirgwwdtlpqeeksnvlkylsnieeeeisrgliegavssvariaiipmqdvlglgs
    dsrmnipatqfgnwswripsstsfdnldaeakklrdilatygrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1nA (A:)
    vpavgedfpidyadwlpkrdpndrrragillhptsfpgpygigdlgpqafkfldwlhlag
    cslwqvlplvppgkrgnedgspysgqdancgntllisleelvddgllkmeelpeplptdr
    vnystiseikdplitkaakrllssegelkdqlenfrrdpnisswledaayfaaidnsvnt
    iswydwpeplknrhlaaleevyqsekdfidifiaqqflfqrqwkkvrdyarskgisimgd
    mpiyvgyhsadvwankkqfllnrkgfplivsgvppdafsetgqlwgsplydwkamekdgf
    swwvrriqratdlfdefridhfrgfagfwavpseekiailgrwkvgpgkplfdailqavg
    kiniiaedlgvitedvvqlrksieapgmavlqfafgsdaenphlphnheqnqvvytgthd
    ndtirgwwdtlpqeeksnvlkylsnieeeeisrgliegavssvariaiipmqdvlglgsd
    srmnipatqfgnwswripsstsfdnldaeakklrdilatygrl