SCOPe 2.08: Domain d1wzmb1: 1wzm B:1-120

Lineage for d1wzmb1 (1wzm B:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (12 PDB entries)

8. Domain d1wzmb1: 1wzm B:1-120 [121522]
   Other proteins in same PDB: d1wzma2, d1wzma3, d1wzmb2, d1wzmb3
   automatically matched to d1bvza1
   complexed with ca
   has additional insertions and/or extensions that are not grouped together

Details for d1wzmb1

PDB Entry: 1wzm, 3.2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) mutatnt r469k

PDB Compounds: (B:) alpha-amylase II

SCOPe Domain Sequences for d1wzmb1:

Sequence; same for both SEQRES and ATOM records:

>d1wzmb1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1wzmb1:

• d1wzmb1 first appeared in SCOP 1.73
  
• d1wzmb1 appears in SCOPe 2.07