Lineage for d1wzma2 (1wzm A:503-585)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. Protein Maltogenic amylase [51031] (4 species)
  7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)
  8. Domain d1wzma2: 1wzm A:503-585 [121520]
    Other proteins in same PDB: d1wzma1, d1wzma3, d1wzmb1, d1wzmb3
    automatically matched to d1bvza2
    complexed with ca

Details for d1wzma2

PDB Entry: 1wzm (more details), 3.2 Å

PDB Description: Thermoactinomyces vulgaris R-47 alpha-amylase II (TVA II) mutatnt R469K
PDB Compounds: (A:) alpha-amylase II

SCOPe Domain Sequences for d1wzma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzma2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1wzma2 are not available.

Timeline for d1wzma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wzma1, d1wzma3
View in 3D
Domains from other chains:
(mouse over for more information)
d1wzmb1, d1wzmb2, d1wzmb3