![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein automated matches [190099] (31 species) not a true protein |
![]() | Species Thermoactinomyces vulgaris [TaxId:2026] [254920] (8 PDB entries) |
![]() | Domain d1wzkb3: 1wzk B:121-502 [121512] Other proteins in same PDB: d1wzka1, d1wzka2, d1wzkb1, d1wzkb2 automated match to d1ji2a3 complexed with ca |
PDB Entry: 1wzk (more details), 2.3 Å
SCOPe Domain Sequences for d1wzkb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzkb3 c.1.8.1 (B:121-502) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatnpdcrrpmiweekeqn rglfefykelirlrhrlasltr
Timeline for d1wzkb3: