Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries) |
Domain d1wzkb2: 1wzk B:503-585 [121511] Other proteins in same PDB: d1wzka1, d1wzka3, d1wzkb1, d1wzkb3 automated match to d1wzla2 complexed with ca |
PDB Entry: 1wzk (more details), 2.3 Å
SCOPe Domain Sequences for d1wzkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzkb2 b.71.1.0 (B:503-585) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev hgkqgqlkltlrpyqgmilwngr
Timeline for d1wzkb2: