SCOPe 2.07: Domain d1wzca1: 1wzc A:1-243

Lineage for d1wzca1 (1wzc A:1-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) [117505] (2 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142156] (1 PDB entry)
   Uniprot O58690 1-243

8. Domain d1wzca1: 1wzc A:1-243 [121491]
   Other proteins in same PDB: d1wzca2, d1wzcb3
   complexed with mg, po4

Details for d1wzca1

PDB Entry: 1wzc, 1.9 Å

PDB Description: crystal structure of pyrococcus horikoshii mannosyl-3-phosphoglycerate phosphatase complexed with mg2+ and phosphate

PDB Compounds: (A:) Mannosyl-3-phosphoglycerate phosphatase

SCOPe Domain Sequences for d1wzca1:

Sequence, based on SEQRES records:

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk
eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk
gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle
vik

Sequence, based on observed residues (ATOM records):

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpyivielgirvekireelkkleniyglkyygnstkeeiekftgmp
pelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdkgkaakilldf
ykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvlevik

Timeline for d1wzca1:

• d1wzca1 first appeared in SCOP 1.73
  
• d1wzca1 appears in SCOPe 2.06
  
• d1wzca1 appears in the current release, SCOPe 2.08