Lineage for d1wzca1 (1wzc A:1-243)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712401Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 712437Protein Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) [117505] (2 species)
  7. 712438Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142156] (1 PDB entry)
  8. 712439Domain d1wzca1: 1wzc A:1-243 [121491]
    complexed with mg, po4; mutant

Details for d1wzca1

PDB Entry: 1wzc (more details), 1.9 Å

PDB Description: crystal structure of pyrococcus horikoshii mannosyl-3-phosphoglycerate phosphatase complexed with mg2+ and phosphate
PDB Compounds: (A:) Mannosyl-3-phosphoglycerate phosphatase

SCOP Domain Sequences for d1wzca1:

Sequence, based on SEQRES records: (download)

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk
eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk
gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle
vik

Sequence, based on observed residues (ATOM records): (download)

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpyivielgirvekireelkkleniyglkyygnstkeeiekftgmp
pelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdkgkaakilldf
ykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvlevik

SCOP Domain Coordinates for d1wzca1:

Click to download the PDB-style file with coordinates for d1wzca1.
(The format of our PDB-style files is described here.)

Timeline for d1wzca1: