Lineage for d1wzcb2 (1wzc B:1-243)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527199Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2527232Protein Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) [117505] (2 species)
  7. 2527236Species Pyrococcus horikoshii [TaxId:53953] [142156] (1 PDB entry)
    Uniprot O58690 1-243
  8. 2527238Domain d1wzcb2: 1wzc B:1-243 [121492]
    Other proteins in same PDB: d1wzca2, d1wzcb3
    automated match to d1wzca1
    complexed with mg, po4

Details for d1wzcb2

PDB Entry: 1wzc (more details), 1.9 Å

PDB Description: crystal structure of pyrococcus horikoshii mannosyl-3-phosphoglycerate phosphatase complexed with mg2+ and phosphate
PDB Compounds: (B:) Mannosyl-3-phosphoglycerate phosphatase

SCOPe Domain Sequences for d1wzcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzcb2 c.108.1.10 (B:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Pyrococcus horikoshii [TaxId: 53953]}
mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf
isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk
eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk
gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle
vik

SCOPe Domain Coordinates for d1wzcb2:

Click to download the PDB-style file with coordinates for d1wzcb2.
(The format of our PDB-style files is described here.)

Timeline for d1wzcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wzcb3