![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
![]() | Protein Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) [117505] (2 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142156] (1 PDB entry) Uniprot O58690 1-243 |
![]() | Domain d1wzcb2: 1wzc B:1-243 [121492] Other proteins in same PDB: d1wzca2, d1wzcb3 automated match to d1wzca1 complexed with mg, po4 |
PDB Entry: 1wzc (more details), 1.9 Å
SCOPe Domain Sequences for d1wzcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzcb2 c.108.1.10 (B:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Pyrococcus horikoshii [TaxId: 53953]} mirlifldidktlipgyepdpakpiieelkdmgfeiifnssktraeqeyyrkelevetpf isengsaifipkgyfpfdvkgkevgnyivielgirvekireelkkleniyglkyygnstk eeiekftgmppelvplamereysetifewsrdgweevlveggfkvtmgsrfytvhgnsdk gkaakilldfykrlgqiesyavgdsyndfpmfevvdkvfivgslkhkkaqnvssiidvle vik
Timeline for d1wzcb2: