SCOPe 2.08: Domain d1wy7c_: 1wy7 C:

Lineage for d1wy7c_ (1wy7 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.32: Ta1320-like [89751] (2 proteins)

6. Protein Hypothetical protein PH1948 [142593] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [142594] (1 PDB entry)
   Uniprot O59611 4-204

8. Domain d1wy7c_: 1wy7 C: [121435]
   automated match to d1wy7a1
   complexed with sah

Details for d1wy7c_

PDB Entry: 1wy7, 2.2 Å

PDB Description: crystal structure of a putative RNA methyltransferase PH1948 from Pyrococcus horikoshii

PDB Compounds: (C:) hypothetical protein PH1948

SCOPe Domain Sequences for d1wy7c_:

Sequence, based on SEQRES records:

>d1wy7c_ c.66.1.32 (C:) Hypothetical protein PH1948 {Pyrococcus horikoshii [TaxId: 53953]}
mmtrkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagt
gvlsygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnp
pfgsqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieip
lqfffhrkkleritvdiyrfskvinsr

Sequence, based on observed residues (ATOM records):

>d1wy7c_ c.66.1.32 (C:) Hypothetical protein PH1948 {Pyrococcus horikoshii [TaxId: 53953]}
mmtrkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagt
gvlsygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnp
pfgsqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieip
rkkleritvdiyrfskvinsr

Timeline for d1wy7c_:

• d1wy7c_ first appeared in SCOP 1.73, called d1wy7c1
  
• d1wy7c_ appears in SCOPe 2.07