![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.32: Ta1320-like [89751] (2 proteins) |
![]() | Protein Hypothetical protein PH1948 [142593] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [142594] (1 PDB entry) Uniprot O59611 4-204 |
![]() | Domain d1wy7a1: 1wy7 A:4-204 [121433] complexed with sah |
PDB Entry: 1wy7 (more details), 2.2 Å
SCOPe Domain Sequences for d1wy7a1:
Sequence, based on SEQRES records: (download)
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Pyrococcus horikoshii [TaxId: 53953]} rkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagtgvl sygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnppfg sqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieiplqf ffhrkkleritvdiyrfskvi
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Pyrococcus horikoshii [TaxId: 53953]} rkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagtgvl sygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnppfg sqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieiphrk kleritvdiyrfskvi
Timeline for d1wy7a1: