Lineage for d1wy7a1 (1wy7 A:4-204)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893930Family c.66.1.32: Ta1320-like [89751] (2 proteins)
  6. 2893931Protein Hypothetical protein PH1948 [142593] (1 species)
  7. 2893932Species Pyrococcus horikoshii [TaxId:53953] [142594] (1 PDB entry)
    Uniprot O59611 4-204
  8. 2893933Domain d1wy7a1: 1wy7 A:4-204 [121433]
    complexed with sah

Details for d1wy7a1

PDB Entry: 1wy7 (more details), 2.2 Å

PDB Description: crystal structure of a putative RNA methyltransferase PH1948 from Pyrococcus horikoshii
PDB Compounds: (A:) hypothetical protein PH1948

SCOPe Domain Sequences for d1wy7a1:

Sequence, based on SEQRES records: (download)

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Pyrococcus horikoshii [TaxId: 53953]}
rkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagtgvl
sygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnppfg
sqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieiplqf
ffhrkkleritvdiyrfskvi

Sequence, based on observed residues (ATOM records): (download)

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Pyrococcus horikoshii [TaxId: 53953]}
rkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagtgvl
sygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnppfg
sqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieiphrk
kleritvdiyrfskvi

SCOPe Domain Coordinates for d1wy7a1:

Click to download the PDB-style file with coordinates for d1wy7a1.
(The format of our PDB-style files is described here.)

Timeline for d1wy7a1: