PDB entry 1wy7

View 1wy7 on RCSB PDB site
Description: crystal structure of a putative RNA methyltransferase PH1948 from Pyrococcus horikoshii
Class: transferase
Keywords: seven-stranded beta sheet, methyltransferase fold, STRUCTURAL GENOMICS, TRANSFERASE
Deposited on 2005-02-08, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.242
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1948
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1948
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59611
      • modified residue (117)
    Domains in SCOPe 2.07: d1wy7a1
  • Chain 'B':
    Compound: hypothetical protein PH1948
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1948
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59611
      • modified residue (1)
      • modified residue (117)
    Domains in SCOPe 2.07: d1wy7b_
  • Chain 'C':
    Compound: hypothetical protein PH1948
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1948
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59611 (0-206)
      • modified residue (0-1)
      • modified residue (117)
    Domains in SCOPe 2.07: d1wy7c_
  • Chain 'D':
    Compound: hypothetical protein PH1948
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1948
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59611 (0-End)
      • modified residue (0-1)
      • modified residue (117)
    Domains in SCOPe 2.07: d1wy7d_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wy7A (A:)
    mmtrkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagt
    gvlsygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnp
    pfgsqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieip
    lqfffhrkkleritvdiyrfskvinsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wy7A (A:)
    rkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagtgvl
    sygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnppfg
    sqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieiphrk
    kleritvdiyrfskvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wy7B (B:)
    mmtrkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagt
    gvlsygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnp
    pfgsqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieip
    lqfffhrkkleritvdiyrfskvinsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wy7B (B:)
    mtrkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagtg
    vlsygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnpp
    fgsqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieipl
    qkkleritvdiyrfskvi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wy7C (C:)
    mmtrkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagt
    gvlsygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnp
    pfgsqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieip
    lqfffhrkkleritvdiyrfskvinsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wy7C (C:)
    mmtrkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagt
    gvlsygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnp
    pfgsqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieip
    rkkleritvdiyrfskvinsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wy7D (D:)
    mmtrkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagt
    gvlsygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnp
    pfgsqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieip
    lqfffhrkkleritvdiyrfskvinsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wy7D (D:)
    mmtrkkelaialsklkgfknpkvwleqyrtpgnaasellwlayslgdiegkvvadlgagt
    gvlsygalllgakevicvevdkeavdvlienlgefkgkfkvfigdvsefnsrvdivimnp
    pfgsqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieip
    lqfffhrkkleritvdiyrfskvi