SCOPe 2.08: Domain d1wxza_: 1wxz A:

Lineage for d1wxza_ (1wxz A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)

6. Protein automated matches [190078] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186799] (5 PDB entries)

8. Domain d1wxza_: 1wxz A: [121427]
   automated match to d1w1ie_
   complexed with frl, zn

Details for d1wxza_

PDB Entry: 1wxz, 2.8 Å

PDB Description: crystal structure of adenosine deaminase ligated with a potent inhibitor

PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d1wxza_:

Sequence; same for both SEQRES and ATOM records:

>d1wxza_ c.1.9.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr

Timeline for d1wxza_:

• d1wxza_ first appeared in SCOP 1.73, called d1wxza1
  
• d1wxza_ appears in SCOPe 2.07