Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins) |
Protein automated matches [190078] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [186799] (5 PDB entries) |
Domain d1wxza_: 1wxz A: [121427] automated match to d1w1ie_ complexed with frl, zn |
PDB Entry: 1wxz (more details), 2.8 Å
SCOPe Domain Sequences for d1wxza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wxza_ c.1.9.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr
Timeline for d1wxza_: