PDB entry 1wxz

View 1wxz on RCSB PDB site
Description: Crystal structure of adenosine deaminase ligated with a potent inhibitor
Class: hydrolase
Keywords: beta barel, HYDROLASE
Deposited on 2005-02-02, released 2005-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine deaminase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56658
      • see remark 999 (6)
      • see remark 999 (30-31)
      • see remark 999 (55)
      • see remark 999 (58)
      • see remark 999 (75)
      • see remark 999 (77)
      • see remark 999 (197)
      • see remark 999 (244)
      • see remark 999 (259)
      • see remark 999 (277)
      • see remark 999 (279)
      • see remark 999 (311-312)
      • see remark 999 (350)
    Domains in SCOPe 2.08: d1wxza_
  • Heterogens: ZN, FRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wxzA (A:)
    aqtpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdf
    lakfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqae
    gdltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaid
    lagdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyh
    tledttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifk
    stldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmpspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wxzA (A:)
    tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla
    kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
    ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
    gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
    edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr