Lineage for d1wxxb1 (1wxx B:1-64)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2411564Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2411565Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2411728Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
    N-terminal part of Pfam PF03602, structurally similar to PUA domain family
  6. 2411737Protein Hypothetical protein TTHA1280, N-terminal domain [141717] (1 species)
  7. 2411738Species Thermus thermophilus [TaxId:274] [141718] (3 PDB entries)
    Uniprot Q5SIT4 1-164
  8. 2411740Domain d1wxxb1: 1wxx B:1-64 [121420]
    Other proteins in same PDB: d1wxxa2, d1wxxb2, d1wxxc2, d1wxxd2
    automated match to d1wxwa1
    complexed with k, po4

Details for d1wxxb1

PDB Entry: 1wxx (more details), 1.8 Å

PDB Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8
PDB Compounds: (B:) hypothetical protein TTHA1280

SCOPe Domain Sequences for d1wxxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxxb1 b.122.1.9 (B:1-64) Hypothetical protein TTHA1280, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
rfap

SCOPe Domain Coordinates for d1wxxb1:

Click to download the PDB-style file with coordinates for d1wxxb1.
(The format of our PDB-style files is described here.)

Timeline for d1wxxb1: