PDB entry 1wxx

View 1wxx on RCSB PDB site
Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8
Class: transferase
Keywords: Thermus thermophillus, methyltransferase, Adomet, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, TRANSFERASE
Deposited on 2005-02-02, released 2005-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA1280
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIT4 (0-381)
      • modified residue (0)
      • modified residue (204)
      • modified residue (329)
      • modified residue (337)
    Domains in SCOPe 2.08: d1wxxa1, d1wxxa2
  • Chain 'B':
    Compound: hypothetical protein TTHA1280
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIT4 (0-381)
      • modified residue (0)
      • modified residue (204)
      • modified residue (329)
      • modified residue (337)
    Domains in SCOPe 2.08: d1wxxb1, d1wxxb2
  • Chain 'C':
    Compound: hypothetical protein TTHA1280
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIT4 (0-381)
      • modified residue (0)
      • modified residue (204)
      • modified residue (329)
      • modified residue (337)
    Domains in SCOPe 2.08: d1wxxc1, d1wxxc2
  • Chain 'D':
    Compound: hypothetical protein TTHA1280
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIT4 (0-381)
      • modified residue (0)
      • modified residue (204)
      • modified residue (329)
      • modified residue (337)
    Domains in SCOPe 2.08: d1wxxd1, d1wxxd2
  • Heterogens: K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxxA (A:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxxB (B:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxxC (C:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wxxD (D:)
    mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
    rfapaedpvaallenlaqalarreavlrqdpeggyrlvhaegdllpglvvdyyaghavvq
    atahawegllpqvaealrphvqsvlakndartreleglplyvrpllgevpervqvqegrv
    rylvdlragqktgayldqrenrlymerfrgeraldvfsyaggfalhlalgfrevvavdss
    aealrraeenarlnglgnvrvleanafdllrrlekegerfdlvvldppafakgkkdvera
    yraykevnlraikllkeggilatascshhmteplfyamvaeaaqdahrllrvvekrgqpf
    dhpvllnhpethylkfavfqvl