SCOPe 2.08: Domain d1wxxd1: 1wxx D:1-64

Lineage for d1wxxd1 (1wxx D:1-64)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
   N-terminal part of Pfam PF03602, structurally similar to PUA domain family

6. Protein Hypothetical protein TTHA1280, N-terminal domain [141717] (1 species)

7. Species Thermus thermophilus [TaxId:274] [141718] (3 PDB entries)
   Uniprot Q5SIT4 1-164

8. Domain d1wxxd1: 1wxx D:1-64 [121424]
   Other proteins in same PDB: d1wxxa2, d1wxxb2, d1wxxc2, d1wxxd2
   automated match to d1wxwa1
   complexed with k, po4

Details for d1wxxd1

PDB Entry: 1wxx, 1.8 Å

PDB Description: Crystal structure of Tt1595, a putative SAM-dependent methyltransferase from Thermus thermophillus HB8

PDB Compounds: (D:) hypothetical protein TTHA1280

SCOPe Domain Sequences for d1wxxd1:

Sequence; same for both SEQRES and ATOM records:

>d1wxxd1 b.122.1.9 (D:1-64) Hypothetical protein TTHA1280, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mriqvnakgaarllsrhlwvfrrdvvsgpetpglypvywgrrflalalynphtdlavray
rfap

Timeline for d1wxxd1:

• d1wxxd1 first appeared in SCOP 1.73
  
• d1wxxd1 appears in SCOPe 2.07