Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
Domain d1wv7l2: 1wv7 L:87-142 [121322] Other proteins in same PDB: d1wv7h_, d1wv7l3, d1wv7t1, d1wv7t2 automated match to d1danl2 complexed with 5pi, bgc, ca, fuc |
PDB Entry: 1wv7 (more details), 2.7 Å
SCOPe Domain Sequences for d1wv7l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wv7l2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d1wv7l2: