SCOPe 2.08: Domain d1wv7l2: 1wv7 L:87-142

Lineage for d1wv7l2 (1wv7 L:87-142)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d1wv7l2: 1wv7 L:87-142 [121322]
   Other proteins in same PDB: d1wv7h_, d1wv7l3, d1wv7t1, d1wv7t2
   automated match to d1danl2
   complexed with 5pi, bgc, ca, fuc

Details for d1wv7l2

PDB Entry: 1wv7, 2.7 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d-5- propoxy-trp-gln-p-aminobenzamidine

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wv7l2:

Sequence; same for both SEQRES and ATOM records:

>d1wv7l2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d1wv7l2:

• d1wv7l2 first appeared in SCOP 1.73
  
• d1wv7l2 appears in SCOPe 2.07