SCOP 1.73: Domain d1wv7l2: 1wv7 L:91-140

Lineage for d1wv7l2 (1wv7 L:91-140)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)

8. Domain d1wv7l2: 1wv7 L:91-140 [121322]
   Other proteins in same PDB: d1wv7h1, d1wv7l3, d1wv7t1, d1wv7t2
   automatically matched to d1pfxl2
   complexed with 5pi, bgc, ca, fuc

Details for d1wv7l2

PDB Entry: 1wv7, 2.7 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d-5- propoxy-trp-gln-p-aminobenzamidine

PDB Compounds: (L:) Coagulation factor VII

SCOP Domain Sequences for d1wv7l2:

Sequence; same for both SEQRES and ATOM records:

>d1wv7l2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

Timeline for d1wv7l2:

• d1wv7l2 is new in SCOP 1.73
  
• d1wv7l2 appears in SCOP 1.75
  
• d1wv7l2 appears in the current release, SCOPe 2.08