SCOP 1.73: Domain d1wtfc1: 1wtf C:1-81

Lineage for d1wtfc1 (1wtf C:1-81)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
   contains only one 4Fe-4S cluster

6. Protein Ferredoxin [54882] (1 species)

7. Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (3 PDB entries)

8. Domain d1wtfc1: 1wtf C:1-81 [121260]
   automatically matched to d1iqza_
   complexed with coa, f3s, so4

Details for d1wtfc1

PDB Entry: 1wtf, 1.6 Å

PDB Description: Crystal structure of Bacillus thermoproteolyticus Ferredoxin Variants Containing Unexpected [3Fe-4S] Cluster that is linked to Coenzyme A at 1.6 A Resolution

PDB Compounds: (C:) ferredoxin

SCOP Domain Sequences for d1wtfc1:

Sequence; same for both SEQRES and ATOM records:

>d1wtfc1 d.58.1.4 (C:1-81) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]}
pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
cptdsikvadepfdgdpnkfe

Timeline for d1wtfc1:

• d1wtfc1 is new in SCOP 1.73
  
• d1wtfc1 appears in SCOP 1.75
  
• d1wtfc1 appears in the current release, SCOPe 2.08, called d1wtfc_