Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) |
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins) contains only one 4Fe-4S cluster |
Protein Ferredoxin [54882] (1 species) |
Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (3 PDB entries) |
Domain d1wtfc1: 1wtf C:1-81 [121260] automatically matched to d1iqza_ complexed with coa, f3s, so4 |
PDB Entry: 1wtf (more details), 1.6 Å
SCOP Domain Sequences for d1wtfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wtfc1 d.58.1.4 (C:1-81) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg cptdsikvadepfdgdpnkfe
Timeline for d1wtfc1: