Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) |
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins) contains only one 4Fe-4S cluster |
Protein Ferredoxin [54882] (1 species) |
Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (3 PDB entries) |
Domain d1iqza_: 1iqz A: [66281] complexed with fs4, sul |
PDB Entry: 1iqz (more details), 0.92 Å
SCOP Domain Sequences for d1iqza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg cptdsikvadepfdgdpnkfe
Timeline for d1iqza_: