Lineage for d1iqza_ (1iqz A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603244Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 603317Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
    contains only one 4Fe-4S cluster
  6. 603324Protein Ferredoxin [54882] (1 species)
  7. 603325Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (2 PDB entries)
  8. 603326Domain d1iqza_: 1iqz A: [66281]
    complexed with fs4, sul

Details for d1iqza_

PDB Entry: 1iqz (more details), 0.92 Å

PDB Description: oxidized [4fe-4s] ferredoxin from bacillus thermoproteolyticus (form i)

SCOP Domain Sequences for d1iqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus}
pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
cptdsikvadepfdgdpnkfe

SCOP Domain Coordinates for d1iqza_:

Click to download the PDB-style file with coordinates for d1iqza_.
(The format of our PDB-style files is described here.)

Timeline for d1iqza_: