Lineage for d1iqza_ (1iqz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949195Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins)
    contains only one 4Fe-4S cluster
    automatically mapped to Pfam PF13459
    automatically mapped to Pfam PF13370
  6. 2949206Protein Ferredoxin [54882] (1 species)
  7. 2949207Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (2 PDB entries)
  8. 2949208Domain d1iqza_: 1iqz A: [66281]
    complexed with sf4, so4

Details for d1iqza_

PDB Entry: 1iqz (more details), 0.92 Å

PDB Description: oxidized [4fe-4s] ferredoxin from bacillus thermoproteolyticus (form i)
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1iqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]}
pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
cptdsikvadepfdgdpnkfe

SCOPe Domain Coordinates for d1iqza_:

Click to download the PDB-style file with coordinates for d1iqza_.
(The format of our PDB-style files is described here.)

Timeline for d1iqza_: