PDB entry 1iqz

View 1iqz on RCSB PDB site
Description: OXIDIZED [4Fe-4S] FERREDOXIN FROM BACILLUS THERMOPROTEOLYTICUS (FORM I)
Class: electron transport
Keywords: ferredoxin, iron-sulfer protein, ultlahigh resolution analysis, geometry of [4fe-4s] cluster, electron transport
Deposited on 2001-08-30, released 2002-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.098
AEROSPACI score: 1.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Bacillus thermoproteolyticus [TaxId:1427]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1iqza_
  • Heterogens: SO4, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqzA (A:)
    pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
    cptdsikvadepfdgdpnkfe