![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins) contains only one 4Fe-4S cluster automatically mapped to Pfam PF13459 automatically mapped to Pfam PF13370 |
![]() | Protein automated matches [190107] (2 species) not a true protein |
![]() | Species Bacillus thermoproteolyticus [TaxId:1427] [186831] (1 PDB entry) |
![]() | Domain d1wtfc_: 1wtf C: [121260] automated match to d1iqza_ complexed with coa, f3s, so4 |
PDB Entry: 1wtf (more details), 1.6 Å
SCOPe Domain Sequences for d1wtfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wtfc_ d.58.1.4 (C:) automated matches {Bacillus thermoproteolyticus [TaxId: 1427]} pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg cptdsikvadepfdgdpnkfe
Timeline for d1wtfc_: