Lineage for d1wtca_ (1wtc A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2480954Protein automated matches [190054] (13 species)
    not a true protein
  7. 2480971Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188093] (3 PDB entries)
  8. 2480973Domain d1wtca_: 1wtc A: [121257]
    automated match to d1v71a1
    complexed with acp, mg, plp

Details for d1wtca_

PDB Entry: 1wtc (more details), 1.9 Å

PDB Description: Crystal Structure of S.pombe Serine Racemase complex with AMPPCP
PDB Compounds: (A:) Hypothetical protein C320.14 in chromosome III

SCOPe Domain Sequences for d1wtca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtca_ c.79.1.1 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrgalnal
sqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyggqvim
ydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfvclggg
gllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtqhlgny
tfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklknkrigi
iisggnvdieryahflsq

SCOPe Domain Coordinates for d1wtca_:

Click to download the PDB-style file with coordinates for d1wtca_.
(The format of our PDB-style files is described here.)

Timeline for d1wtca_: