Lineage for d1wtca1 (1wtc A:6-323)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708963Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 708964Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 708965Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 709051Protein Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) [142749] (1 species)
  7. 709052Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [142750] (2 PDB entries)
  8. 709054Domain d1wtca1: 1wtc A:6-323 [121257]
    automatically matched to 1V71 A:6-323
    complexed with acp, mg, plp

Details for d1wtca1

PDB Entry: 1wtc (more details), 1.9 Å

PDB Description: Crystal Structure of S.pombe Serine Racemase complex with AMPPCP
PDB Compounds: (A:) Hypothetical protein C320.14 in chromosome III

SCOP Domain Sequences for d1wtca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtca1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vlptyddvasaserikkfanktpvltsstvnkefvaevffkcenfqkmgafkfrgalnal
sqlneaqrkagvltfssgnhaqaialsakilgipakiimpldapeakvaatkgyggqvim
ydrykddrekmakeiseregltiippydhphvlagqgtaakelfeevgpldalfvclggg
gllsgsalaarhfapncevygvepeagndgqqsfrkgsivhidtpktiadgaqtqhlgny
tfsiikekvddiltvsdeelidclkfyaarmkivveptgclsfaaaramkeklknkrigi
iisggnvdieryahflsq

SCOP Domain Coordinates for d1wtca1:

Click to download the PDB-style file with coordinates for d1wtca1.
(The format of our PDB-style files is described here.)

Timeline for d1wtca1: