Lineage for d1wssl2 (1wss L:91-140)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062362Protein Factor IX (IXa) [57198] (2 species)
  7. 1062376Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 1062396Domain d1wssl2: 1wss L:91-140 [121240]
    Other proteins in same PDB: d1wssh_, d1wssl3, d1wsst1, d1wsst2
    automatically matched to d1pfxl2
    complexed with 3cb, bgc, ca, fuc

Details for d1wssl2

PDB Entry: 1wss (more details), 2.6 Å

PDB Description: Human Factor Viia-Tissue Factor in Complex with peptide-mimetic inhibitor that has two charged groups in P2 and P4
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wssl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wssl2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

SCOPe Domain Coordinates for d1wssl2:

Click to download the PDB-style file with coordinates for d1wssl2.
(The format of our PDB-style files is described here.)

Timeline for d1wssl2: