SCOPe 2.01: Domain d1wssl2: 1wss L:91-140

Lineage for d1wssl2 (1wss L:91-140)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)

8. Domain d1wssl2: 1wss L:91-140 [121240]
   Other proteins in same PDB: d1wssh_, d1wssl3, d1wsst1, d1wsst2
   automatically matched to d1pfxl2
   complexed with 3cb, bgc, ca, fuc

Details for d1wssl2

PDB Entry: 1wss, 2.6 Å

PDB Description: human factor viia-tissue factor in complex with peptide-mimetic inhibitor that has two charged groups in p2 and p4

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wssl2:

Sequence; same for both SEQRES and ATOM records:

>d1wssl2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

Timeline for d1wssl2:

• d1wssl2 first appeared in SCOP 1.73
  
• d1wssl2 appears in SCOP 1.75
  
• d1wssl2 appears in SCOPe 2.02
  
• d1wssl2 appears in the current release, SCOPe 2.08