Lineage for d1wsst1 (1wss T:6-108)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 935829Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 935858Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)
  8. 935885Domain d1wsst1: 1wss T:6-108 [121242]
    Other proteins in same PDB: d1wssh_, d1wssl1, d1wssl2, d1wssl3
    automatically matched to d1a21a1
    complexed with 3cb, bgc, ca, fuc

Details for d1wsst1

PDB Entry: 1wss (more details), 2.6 Å

PDB Description: Human Factor Viia-Tissue Factor in Complex with peptide-mimetic inhibitor that has two charged groups in P2 and P4
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1wsst1:

Sequence, based on SEQRES records: (download)

>d1wsst1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records): (download)

>d1wsst1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypeplyenspeftpyletnl

SCOPe Domain Coordinates for d1wsst1:

Click to download the PDB-style file with coordinates for d1wsst1.
(The format of our PDB-style files is described here.)

Timeline for d1wsst1: