SCOPe 2.02: Domain d1wp0c_: 1wp0 C:

Lineage for d1wp0c_ (1wp0 C:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187259] (5 PDB entries)

8. Domain d1wp0c_: 1wp0 C: [121134]
   Other proteins in same PDB: d1wp0a1
   automated match to d1wp0a1

Details for d1wp0c_

PDB Entry: 1wp0, 2.8 Å

PDB Description: Human SCO1

PDB Compounds: (C:) SCO1 protein homolog

SCOPe Domain Sequences for d1wp0c_:

Sequence; same for both SEQRES and ATOM records:

>d1wp0c_ c.47.1.10 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdl
tplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededy
ivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpy

Timeline for d1wp0c_:

• d1wp0c_ first appeared in SCOP 1.73, called d1wp0c1
  
• d1wp0c_ appears in SCOPe 2.01
  
• d1wp0c_ appears in SCOPe 2.03
  
• d1wp0c_ appears in the current release, SCOPe 2.08