Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries) |
Domain d1wp0c_: 1wp0 C: [121134] Other proteins in same PDB: d1wp0a1 automated match to d1wp0a1 |
PDB Entry: 1wp0 (more details), 2.8 Å
SCOPe Domain Sequences for d1wp0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wp0c_ c.47.1.10 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mgpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdl tplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededy ivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpy
Timeline for d1wp0c_: