SCOP 1.73: Domain d1wmic1: 1wmi C:1-88

Lineage for d1wmic1 (1wmi C:1-88)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (2 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.2: RelE-like [143015] (2 proteins)
   Pfam PF05016

6. Protein Hypothetical protein PHS013 [143016] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143017] (1 PDB entry)

8. Domain d1wmic1: 1wmi C:1-88 [121047]
   Other proteins in same PDB: d1wmib1, d1wmid1
   automatically matched to 1WMI A:1-88

Details for d1wmic1

PDB Entry: 1wmi, 2.3 Å

PDB Description: Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3

PDB Compounds: (C:) hypothetical protein PHS013

SCOP Domain Sequences for d1wmic1:

Sequence; same for both SEQRES and ATOM records:

>d1wmic1 d.298.1.2 (C:1-88) Hypothetical protein PHS013 {Pyrococcus horikoshii [TaxId: 53953]}
mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar
lgdyrviysvnwkdkvikilklkprgra

Timeline for d1wmic1:

• d1wmic1 is new in SCOP 1.73
  
• d1wmic1 appears in SCOP 1.75
  
• d1wmic1 appears in the current release, SCOPe 2.08, called d1wmic_