Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (2 families) Toxin component of plasmid stabilisation system |
Family d.298.1.2: RelE-like [143015] (2 proteins) Pfam PF05016 |
Protein Hypothetical protein PHS013 [143016] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [143017] (1 PDB entry) Uniprot O73966 1-88 |
Domain d1wmic1: 1wmi C:1-88 [121047] Other proteins in same PDB: d1wmib1, d1wmid1 automatically matched to 1WMI A:1-88 |
PDB Entry: 1wmi (more details), 2.3 Å
SCOP Domain Sequences for d1wmic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmic1 d.298.1.2 (C:1-88) Hypothetical protein PHS013 {Pyrococcus horikoshii [TaxId: 53953]} mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar lgdyrviysvnwkdkvikilklkprgra
Timeline for d1wmic1: