Lineage for d1wmid1 (1wmi D:7-67)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649538Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
    not a true fold
  4. 649665Superfamily a.137.13: RelB-like [141004] (1 family) (S)
    wraps around RelE subunit
  5. 649666Family a.137.13.1: RelB-like [141005] (1 protein)
  6. 649667Protein Hypothetical protein PHS014 [141006] (1 species)
  7. 649668Species Pyrococcus horikoshii [TaxId:53953] [141007] (1 PDB entry)
  8. 649670Domain d1wmid1: 1wmi D:7-67 [121048]
    Other proteins in same PDB: d1wmia1, d1wmic1
    automatically matched to 1WMI B:7-67

Details for d1wmid1

PDB Entry: 1wmi (more details), 2.3 Å

PDB Description: Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3
PDB Compounds: (D:) hypothetical protein PHS014

SCOP Domain Sequences for d1wmid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmid1 a.137.13.1 (D:7-67) Hypothetical protein PHS014 {Pyrococcus horikoshii [TaxId: 53953]}
gdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidaeelpepe
d

SCOP Domain Coordinates for d1wmid1:

Click to download the PDB-style file with coordinates for d1wmid1.
(The format of our PDB-style files is described here.)

Timeline for d1wmid1: