![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
![]() | Superfamily d.298.1: RelE-like [143011] (3 families) ![]() Toxin component of plasmid stabilisation system |
![]() | Family d.298.1.2: RelE-like [143015] (3 proteins) Pfam PF05016 |
![]() | Protein automated matches [190809] (2 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [188081] (1 PDB entry) |
![]() | Domain d1wmic_: 1wmi C: [121047] Other proteins in same PDB: d1wmia1, d1wmib1, d1wmid_ automated match to d1wmia1 |
PDB Entry: 1wmi (more details), 2.3 Å
SCOPe Domain Sequences for d1wmic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmic_ d.298.1.2 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar lgdyrviysvnwkdkvikilklkprgra
Timeline for d1wmic_: