Lineage for d1wmic_ (1wmi C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010146Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 3010147Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 3010167Family d.298.1.2: RelE-like [143015] (3 proteins)
    Pfam PF05016
  6. 3010174Protein automated matches [190809] (2 species)
    not a true protein
  7. 3010181Species Pyrococcus horikoshii OT3 [TaxId:70601] [188081] (1 PDB entry)
  8. 3010182Domain d1wmic_: 1wmi C: [121047]
    Other proteins in same PDB: d1wmia1, d1wmib1, d1wmid_
    automated match to d1wmia1

Details for d1wmic_

PDB Entry: 1wmi (more details), 2.3 Å

PDB Description: Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3
PDB Compounds: (C:) hypothetical protein PHS013

SCOPe Domain Sequences for d1wmic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmic_ d.298.1.2 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar
lgdyrviysvnwkdkvikilklkprgra

SCOPe Domain Coordinates for d1wmic_:

Click to download the PDB-style file with coordinates for d1wmic_.
(The format of our PDB-style files is described here.)

Timeline for d1wmic_: