Lineage for d1wmib1 (1wmi B:7-67)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012578Superfamily a.137.13: RelB-like [141004] (2 families) (S)
    wraps around RelE subunit
  5. 2012579Family a.137.13.1: RelB-like [141005] (1 protein)
  6. 2012580Protein Hypothetical protein PHS014 [141006] (1 species)
  7. 2012581Species Pyrococcus horikoshii [TaxId:53953] [141007] (1 PDB entry)
    Uniprot O73967 7-67
  8. 2012582Domain d1wmib1: 1wmi B:7-67 [121046]
    Other proteins in same PDB: d1wmia1, d1wmic_, d1wmid_

Details for d1wmib1

PDB Entry: 1wmi (more details), 2.3 Å

PDB Description: Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3
PDB Compounds: (B:) hypothetical protein PHS014

SCOPe Domain Sequences for d1wmib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmib1 a.137.13.1 (B:7-67) Hypothetical protein PHS014 {Pyrococcus horikoshii [TaxId: 53953]}
gdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidaeelpepe
d

SCOPe Domain Coordinates for d1wmib1:

Click to download the PDB-style file with coordinates for d1wmib1.
(The format of our PDB-style files is described here.)

Timeline for d1wmib1: