![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.13: RelB-like [141004] (2 families) ![]() wraps around RelE subunit |
![]() | Family a.137.13.0: automated matches [191497] (1 protein) not a true family |
![]() | Protein automated matches [190810] (1 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [188082] (1 PDB entry) |
![]() | Domain d1wmid_: 1wmi D: [121048] Other proteins in same PDB: d1wmia1, d1wmib1, d1wmic_ automated match to d1wmib1 |
PDB Entry: 1wmi (more details), 2.3 Å
SCOPe Domain Sequences for d1wmid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmid_ a.137.13.0 (D:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} gdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidaeelpepe d
Timeline for d1wmid_: