![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries) |
![]() | Domain d1wlpb1: 1wlp B:229-281 [121010] Other proteins in same PDB: d1wlpb3 automatically matched to d1ov3a1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1wlp (more details)
SCOPe Domain Sequences for d1wlpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} epyvaikaytavegdevsllegeavevihklldgwwvirkddvtgyfpsmylq
Timeline for d1wlpb1: