Lineage for d1ov3a1 (1ov3 A:156-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783157Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)
  7. 2783158Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)
  8. 2783163Domain d1ov3a1: 1ov3 A:156-214 [87451]
    Other proteins in same PDB: d1ov3a3, d1ov3b3
    N-terminal domain forms a segment-swapped dimer; C-terminal domain binds a peptide from p22phox, chains C and D
    has additional insertions and/or extensions that are not grouped together

Details for d1ov3a1

PDB Entry: 1ov3 (more details), 1.8 Å

PDB Description: structure of the p22phox-p47phox complex
PDB Compounds: (A:) neutrophil cytosol factor 1

SCOPe Domain Sequences for d1ov3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ov3a1 b.34.2.1 (A:156-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
iilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipasflepld

SCOPe Domain Coordinates for d1ov3a1:

Click to download the PDB-style file with coordinates for d1ov3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ov3a1: