Lineage for d1wlpb1 (1wlp B:229-281)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665317Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)
  7. 665318Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)
  8. 665327Domain d1wlpb1: 1wlp B:229-281 [121010]
    automatically matched to d1ov3a1

Details for d1wlpb1

PDB Entry: 1wlp (more details)

PDB Description: Solution Structure Of The P22Phox-P47Phox Complex
PDB Compounds: (B:) neutrophil cytosol factor 1

SCOP Domain Sequences for d1wlpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
epyvaikaytavegdevsllegeavevihklldgwwvirkddvtgyfpsmylq

SCOP Domain Coordinates for d1wlpb1:

Click to download the PDB-style file with coordinates for d1wlpb1.
(The format of our PDB-style files is described here.)

Timeline for d1wlpb1: