Lineage for d1wkjb1 (1wkj B:1-137)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724293Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries)
  8. 724295Domain d1wkjb1: 1wkj B:1-137 [120984]
    automatically matched to 1WKJ A:1-137

Details for d1wkjb1

PDB Entry: 1wkj (more details), 2 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1wkjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkjb1 d.58.6.1 (B:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]}
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

SCOP Domain Coordinates for d1wkjb1:

Click to download the PDB-style file with coordinates for d1wkjb1.
(The format of our PDB-style files is described here.)

Timeline for d1wkjb1:

Domains from other chains:
(mouse over for more information)
d1wkja1