Lineage for d1wkjb_ (1wkj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951320Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries)
    Uniprot Q5SLV5 1-137
  8. 2951322Domain d1wkjb_: 1wkj B: [120984]
    automated match to d1wkja1

Details for d1wkjb_

PDB Entry: 1wkj (more details), 2 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1wkjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkjb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]}
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

SCOPe Domain Coordinates for d1wkjb_:

Click to download the PDB-style file with coordinates for d1wkjb_.
(The format of our PDB-style files is described here.)

Timeline for d1wkjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wkja1